PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim07g053630.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family G2-like
Protein Properties Length: 544aa    MW: 60045.2 Da    PI: 7.8586
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim07g053630.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like87.21.5e-27255309156
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                         k +++WtpeLH+rFv+aveqL G +kA+P++ile+m++++Lt+++++SHLQkYR++
  Sopim07g053630.0.1 255 KVKVDWTPELHRRFVQAVEQL-GVDKAVPSRILEIMGIDCLTRHNIASHLQKYRSH 309
                         5689*****************.********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.042252311IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.1E-26253312IPR009057Homeodomain-like
SuperFamilySSF466896.63E-18253312IPR009057Homeodomain-like
TIGRFAMsTIGR015572.0E-26255309IPR006447Myb domain, plants
PfamPF002491.8E-7258307IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007165Biological Processsignal transduction
GO:0009658Biological Processchloroplast organization
GO:0009910Biological Processnegative regulation of flower development
GO:0010380Biological Processregulation of chlorophyll biosynthetic process
GO:0010638Biological Processpositive regulation of organelle organization
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1900056Biological Processnegative regulation of leaf senescence
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 544 aa     Download sequence    Send to blast
MTFLYIKYKY LKKTNHFGYI TLYSTIKKYS NHFPSLEFTK LIIILSSLSL FLCSNLGHAR  60
LNLQGKIQKF KNSIYVFIIM LVVSPFSNTT ARDERGNEME SFAIGGGGGG GDDFPDFMGE  120
NLLDSIDFDD LFVGINDGDV LPDLEMDTEI LAEFSVSSGD ESDVNNYSSS NNNNTFITTA  180
IKNVERKEEI EKTGSVSASD VGSGLTTSLN QGEEIVSTQK SEESTQQRNQ NIVTPKESDK  240
GKKSSKNHNL PGKRKVKVDW TPELHRRFVQ AVEQLGVDKA VPSRILEIMG IDCLTRHNIA  300
SHLQKYRSHR KHLLAREVEA ASWSHRRQLY GGAPMVGGGG GKREMNPWPA PTIGFPPPPP  360
LPPPVAPPMP HHFRPLQVWG HPSVDQSYMH MWPKHLAPSP SPQHPSPAWA PPPHHLHPPP  420
PLDPSFWHPH HQRVQNSLTP GTPYFPAPTR YPVPGIPPVS SHGMYKVDQS NIGVRSTATL  480
PAQPLPEPPC DFHPSKESID AAIGDVLSKP WLPLPLGLKP PAVDSVLGEL QRQGVPKIPP  540
TCA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A7e-16252307257ARR10-B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00022PBMTransfer from AT2G20570Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJQ3164600.0JQ316460.1 Solanum lycopersicum golden1-like protein (GLK1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001266193.10.0golden1-like protein
SwissprotQ9SIV33e-92GLK1_ARATH; Transcription activator GLK1
TrEMBLK4CFQ80.0K4CFQ8_SOLLC; Uncharacterized protein
STRINGSolyc07g053630.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA25322356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G20570.17e-74GBF's pro-rich region-interacting factor 1